PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.L01697.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family MYB_related
Protein Properties Length: 789aa    MW: 87538.1 Da    PI: 6.464
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.L01697.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.51.5e-0892134347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT +E+e +  a +q+G++ +++I ++++  +   q++ +++ +
  Migut.L01697.1.p  92 AWTRQEEESFFAALRQYGKN-FEKITSRVQ-SKNKDQVRYYYYRL 134
                       6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.14E-1184139IPR009057Homeodomain-like
PROSITE profilePS5129314.12188139IPR017884SANT domain
SMARTSM007171.9E-789137IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-691137IPR009057Homeodomain-like
PfamPF002492.0E-692134IPR001005SANT/Myb domain
CDDcd001670.0043292126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 789 aa     Download sequence    Send to blast
MVMQVPLDCE PCLAPDNLGN KDGDSSVPSS PQEHVDPKRP AKKQTRQWND SEPCLAPDNL  60
GNKDGDSSVP SSPQENTDPK RPVKKQTRQW AAWTRQEEES FFAALRQYGK NFEKITSRVQ  120
SKNKDQVRYY YYRLVRRMNK LLGPELCLDA KNSKDTNGAM LRWWSLLEKY SCKASKLHLK  180
PRRFKIFVEA LENQLLKDRK KNIKRRLSTG GMNSPVADIP ASNQVRAPGH DNRAVKMVLV  240
EKVGTGKGAL FKRHVNTGIS RTNCKVDTAS VKTTKHKRKT GLASAAACKK WEKAAIAGVS  300
LVADAAEHLE RAETDKEMEK SQEPQSGHDG SELGAPSLQV PSQNMFNDNN IHNSTKLKLQ  360
LFPIDECTQK ALEMDHRNPH LELTLSTRKK ISSVLEHLNR KWGNSKLLCE DLMLFPYWAQ  420
RENLLEYQKW TKDSTLCAAD VYYLIGSPPI FRLRYGWFSK SELESATAQP LSCTNIKEKN  480
SNINIENPSG PRNNHQAVSA EQIITLNSSS VQSGVSVSNI NNSRYRDSTA VLSSIGEASE  540
DLAPENTDMA FSAGEWADTL TNVSMGDLLS DSHNNADANC TDFSLPLSSN CLQQMPFTCD  600
SFDAAIAAHI YKHNKADSQQ ILASHAPSIW DAEVTCDAFA FQKNGAFCGE DKNACMNSSP  660
SSDKEVEELL DVDKFAYSDL NCEDIVDDCR SDHLLENPTK DFGGLTDIYW PNSLGALDLD  720
IPSSCRYNSS DLILNDNSLG GLNRLIANSL DAFQSCSFFG LDKNEPPLTA EAPPQTASIS  780
ISDFKIGS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1199206KKNIKRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012836030.10.0PREDICTED: TSL-kinase interacting protein 1 isoform X1
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLA0A022REX50.0A0A022REX5_ERYGU; Uncharacterized protein (Fragment)
STRINGVIT_08s0040g01460.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA86401719
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.20.0TSL-kinase interacting protein 1